PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00024373001
Common NameGSBRNA2T00024373001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family G2-like
Protein Properties Length: 267aa    MW: 30034.5 Da    PI: 9.0103
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00024373001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.84.5e-32113166255
              G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                          pr+rWt++LH++Fv+av+ LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
  GSBRNA2T00024373001 113 PRMRWTSTLHAHFVHAVQLLGGHERATPKSVLELMNVKDLTLAHVKSHLQMYRT 166
                          9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.68E-15110166IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.6E-28111166IPR009057Homeodomain-like
TIGRFAMsTIGR015575.5E-24113166IPR006447Myb domain, plants
PfamPF002493.9E-7114165IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0080060Biological Processintegument development
GO:0005618Cellular Componentcell wall
GO:0005634Cellular Componentnucleus
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 267 aa     Download sequence    Send to blast
MIMFESRSSV RGSNSVPDLS LQISLPNSHA EKPLHGSERS FTTSSDSGSS LSELSHENSF  60
LKKHLLSLGF DHHHPYHHHQ RHSSNMFQPQ IYGRDFKRTS SSVVSLKRSI RAPRMRWTST  120
LHAHFVHAVQ LLGGHERATP KSVLELMNVK DLTLAHVKSH LQMYRTVKCT DKGSSGERKV  180
EKEAEQKTED NNNNNEDADA DPISPNSPSV QKTQRSPWSS TKGVSMSISQ ADPHMEIYRI  240
TKDDVEKDHL SLEFTLGRPS WGIDHV*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00107PBMTransfer from AT5G42630Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00024373001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013619450.10.0PREDICTED: probable transcription factor KAN4
SwissprotQ9FJV51e-128KAN4_ARATH; Probable transcription factor KAN4
TrEMBLA0A078GEU40.0A0A078GEU4_BRANA; BnaC02g29570D protein
TrEMBLA0A0D3ATF50.0A0A0D3ATF5_BRAOL; Uncharacterized protein
STRINGBra035311.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM65722844
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G42630.11e-111G2-like family protein
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]